Protein Info for SO4097 in Shewanella oneidensis MR-1

Name: mreC
Annotation: rod shape-determining protein MreC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 1 to 268 (268 residues), 232.9 bits, see alignment E=2.2e-73 PF04085: MreC" amino acids 120 to 267 (148 residues), 145.3 bits, see alignment E=6.1e-47

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 100% identity to son:SO_4097)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA12 at UniProt or InterPro

Protein Sequence (355 amino acids)

>SO4097 rod shape-determining protein MreC (NCBI ptt file) (Shewanella oneidensis MR-1)
MKPIFVRGISNQFRLTLAIILSVILLAANHRLEPARESLSSALSPIQYLASVPSAILDWS
SESFATRNMLALQNKELLRQQLLMSERLQRFEHLRQENERLRALLGSPAYQDSRKMVVEV
MEVASEPSHHYVVLNRGSRSGVFVGQPVVDAQGVVGQVVQVSEMTSRVLLVSDVSHGLPV
RITRNDVRLIANGTGELDEIELRHVAKSTDIRVGDLLVTSGLGNRFPEGYPVARVMKVFT
EDGQSYTRVTAQPLAALDRIRYLLLIWPSPDSGVTLPNQIPVPAADHPVEEAKPDAVNGA
INPQGEAQGTNATVPNATVPNTTAPNATVPNATAAPRNANGASNAATTQPPAEVH