Protein Info for SO4091 in Shewanella oneidensis MR-1

Name: tldD
Annotation: tldD protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF01523: PmbA_TldD_1st" amino acids 37 to 100 (64 residues), 58.5 bits, see alignment E=9.2e-20 PF19290: PmbA_TldD_2nd" amino acids 126 to 239 (114 residues), 72 bits, see alignment E=7.8e-24 PF19289: PmbA_TldD_3rd" amino acids 247 to 480 (234 residues), 235.6 bits, see alignment E=6e-74

Best Hits

Swiss-Prot: 65% identical to TLDD_SHIFL: Metalloprotease TldD homolog (tldD) from Shigella flexneri

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to son:SO_4091)

MetaCyc: 65% identical to metalloprotease subunit TldD (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA18 at UniProt or InterPro

Protein Sequence (482 amino acids)

>SO4091 tldD protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPFLAQVEQSLLKGGLALDGLQQYLNSIHQHKVDFSDLYFQGSRHESWVLEDGIIKDGSF
HIERGVGVRAISGEKTGFAYADDITPAALTAAVEAARGIASAGEQTQVQAFKRQKALALY
DSLDPIAAMEEVKKINLLKEADAFIRSLDSRIIQVVVSLAGVHEEILVAASDGTLAADIR
PLVRFNCSVILEENGKRERGGAGGGGRHDYSVLMVNDDTGLPMCFAFAREAVRQAQVNLN
AIDAPAGEMTVVLGNGWPGVLLHEAVGHGLEGDFNRKGSSAFSGMVGQQVASKLVTVVDD
GTLANRRGSLSIDDEGVQTQRTVLIEDGILKGYLQDKLNARLMGVAPTGNGRRESYAHLP
MPRMTNTYMTSGESEPSDIIKSVKKGIYAPNFGGGQVDITSGKFVFSASEAYLIENGEVT
QAIKGATLIGNGPEAMSQISMVGNDMALDKGVGVCGKDGQSVPVGVGQPTLKLDKLTVGG
TA