Protein Info for SO4081 in Shewanella oneidensis MR-1

Annotation: amino acid permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 413 to 430 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 14 to 404 (391 residues), 100.3 bits, see alignment E=1.2e-32 PF00324: AA_permease" amino acids 17 to 402 (386 residues), 105.7 bits, see alignment E=2.5e-34

Best Hits

Swiss-Prot: 64% identical to PLAP_ECO57: Low-affinity putrescine importer PlaP (plaP) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to son:SO_4081)

MetaCyc: 64% identical to putrescine:H+ symporter PlaP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69

Predicted SEED Role

"Putrescine importer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA28 at UniProt or InterPro

Protein Sequence (443 amino acids)

>SO4081 amino acid permease (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQQKPGLKQSLNLWQVVVMGLAYLTPMAVFDTFGIVSEITSGHVATSYLLALAGILFTA
FSYGHLVRKYPYAGSAYTYAQKNFSPNVGFMVGWSSLLDYMFMPMINMLLAKIYLTAMFP
NVEPWIFIFGLVTVMTVLNLRGIDLVANFNGVIVFAQIAIILVFIGLMAHSLSLGEGEGV
IASVRPFYSEQVTLAPLFTGATILCFSFLGFDGLSSLSEETKDAKRVIPRAILLTALIGG
VIFVSVSYFLQLYFPDISRFEQLDAVLPEIALYVGGNLFQSIVLVATTIAVLASGMAAHA
GVARILYVMGRDNMLPNKGFGYVHPKWRTPAFNVVLVGLLALSAVSFDLEMALALVNFGA
LVAFTFVNLSVIVQFYIKEKRNQSLKEHLQYFVLPLCGAATIGVLWINLEPQSLELGLIW
GAVGMLYLALRSLRLRKAVELQS