Protein Info for SO4060 in Shewanella oneidensis MR-1

Name: psrC
Annotation: polysulfide reductase, subunit C (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF03916: NrfD" amino acids 9 to 312 (304 residues), 262.1 bits, see alignment E=4.7e-82

Best Hits

Swiss-Prot: 46% identical to PSRC_WOLSU: Polysulfide reductase chain C (psrC) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: None (inferred from 100% identity to son:SO_4060)

MetaCyc: 46% identical to polysulfide reductase gamma subunit (Wolinella succinogenes)
RXN-8269 [EC: 1.12.98.4]

Predicted SEED Role

"polysulfide reductase, subunit C" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA49 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SO4060 polysulfide reductase, subunit C (NCBI ptt file) (Shewanella oneidensis MR-1)
MNNTWGDMAQYDPVTWHWVIAVYLFMAGLSAGSLLIGIGLRWFNQEQTQVESNILKAAAI
IGPVAISLGLACLVFDLTKPFHFWLILINYNFQSVMAIGVLALLAYSPLAFAYAILVLRD
DLPKWGLGFLVPIAKLLMPFRKLIEVLLFVLAIGVGAYTGFLISAMNAYPMLNTAVLPAL
FLVSGLSAGAAANAVLALVMFKTDSHDKTLAKMHGLELPVMAIEIMFLFMLFCALYFKGG
AAAAALASLTSGVWASVFWIGVVGIGFGVPLLFMLLPAATRHTKGAMIMVACASLTGVLA
LRHFIVYAGQSYLN