Protein Info for SO4058 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 129 to 155 (27 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details PF01925: TauE" amino acids 15 to 235 (221 residues), 74.9 bits, see alignment E=4e-25

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to son:SO_4058)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA51 at UniProt or InterPro

Protein Sequence (247 amino acids)

>SO4058 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFSLIDPQTLAIASVIVFLGALTQSLIGFGLAVVASPLLYIVDPQLVPAPVIVMGFSIAL
LTLLRERGHLEFNGLQYALLGRVPGGFIGASLLLFAPQPVLGLAIAAIVTVAVVLSLYKF
SLPVNKTTLFGAGVISGIFGNIAAIGGPPMAILLAGKDASQFRAALSAFFIFSSAIALTI
LGITGLLEIKHFWLSLMLLPSVLLGYLVAGKLVGSVDKHKTKMATLALCAISALVLTVKS
VIELLPQ