Protein Info for SO4052 in Shewanella oneidensis MR-1

Annotation: transcriptional regulator, MarR family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF12802: MarR_2" amino acids 35 to 95 (61 residues), 38.3 bits, see alignment E=1.8e-13 PF13463: HTH_27" amino acids 37 to 104 (68 residues), 24.9 bits, see alignment E=3.1e-09 PF01047: MarR" amino acids 37 to 94 (58 residues), 35.9 bits, see alignment E=8.3e-13

Best Hits

Swiss-Prot: 41% identical to SLYA_YERPA: Transcriptional regulator SlyA (slyA) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 100% identity to son:SO_4052)

Predicted SEED Role

"Transcriptional regulator SlyA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA57 at UniProt or InterPro

Protein Sequence (157 amino acids)

>SO4052 transcriptional regulator, MarR family (NCBI ptt file) (Shewanella oneidensis MR-1)
MYKELERLKELSLAEHLGRLHRLWRTVADVELAPLGLTHPRWTALWKLLRLGDNVSQKVL
ADALEIELASLMRTLGQLEEQGLVERHCCTKDKRARIVSLTPAGKDVLKQVEARIIRVRG
ELLAGISATELGEFERIISLISENALAKLANSTDILE