Protein Info for SO4050 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 304 to 329 (26 residues), see Phobius details PF11168: DUF2955" amino acids 15 to 154 (140 residues), 176.9 bits, see alignment E=1.1e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4050)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA59 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SO4050 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLRHNPLTANDLRQCLRIATGGTIGFTLCKLFGWSNGVFFTVTPMLLLGLVPVISGHAV
RQLLASSAMAGLEVGLLGGFFGSHPGLMTPLVFLLFLYRFAAMSRGSLFLFGANGVLSLS
IMLHFASYPGTDLNDLIFSNFWATGLSVIIAYLMTALWPDVEPRAAYQPGPKAPHRMRHE
ALLGASIATLSFLVFQIFDLRDSMSAQATTLLLLFPMHWNGALDYARKRAVGTLLGVSFG
VMVQLFLYDWSGLLILIVPLLWLGLMLFAQAHVKEASGSGVGFGAMTTLGILFGQYLTPG
NDLIFSALYRVSSIFVAIVATLFLCYLLHKLLNSFEATRFGY