Protein Info for SO4040 in Shewanella oneidensis MR-1

Annotation: integral membrane domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details PF00892: EamA" amino acids 41 to 175 (135 residues), 62 bits, see alignment E=3.9e-21 amino acids 192 to 299 (108 residues), 38.4 bits, see alignment E=7.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4040)

Predicted SEED Role

"Alr1538 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA69 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SO4040 integral membrane domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTLDLSAVRCQNGVPFLRYYWNLPVNQSHSGPLANNHAQLGLLFISVAVLFWGMLPIAL
KLSGSFIDPVTLTWFRFLVALIVSILVQWSAGSLKQFAALDAKVWLRLILAGLFLMLNYV
SFVYSLDYLAPGAAQLNFQTSPFFLAFGGVLFFKERLNAIQLSCFASLALGMLMFFHPFL
DFSATDNHEIWLGVMIVQFSALSWTTYALLQKSLLNRLSPANVLLVIYALGIFAMAPFSD
FSQFAQMNSFDWQVALFCAANTLIAYGCFGQSMKYWPTAQVSAMLALTPVFSFSATALVV
SIGWWPEVFRADELDALSLFGIGVIIVSVMVVQLLPLYRQRRARRLQPI