Protein Info for SO4014 in Shewanella oneidensis MR-1

Annotation: AcrB/AcrD/AcrF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1023 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 469 to 495 (27 residues), see Phobius details amino acids 533 to 552 (20 residues), see Phobius details amino acids 853 to 872 (20 residues), see Phobius details amino acids 879 to 899 (21 residues), see Phobius details amino acids 905 to 929 (25 residues), see Phobius details amino acids 951 to 971 (21 residues), see Phobius details amino acids 982 to 1006 (25 residues), see Phobius details PF00873: ACR_tran" amino acids 5 to 1008 (1004 residues), 779.7 bits, see alignment E=6.3e-238 PF03176: MMPL" amino acids 308 to 498 (191 residues), 31.3 bits, see alignment E=1.6e-11 PF02355: SecD_SecF" amino acids 335 to 479 (145 residues), 21.4 bits, see alignment E=2.2e-08 amino acids 857 to 1002 (146 residues), 25.8 bits, see alignment E=9.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4014)

Predicted SEED Role

"AcrB/AcrD/AcrF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA94 at UniProt or InterPro

Protein Sequence (1023 amino acids)

>SO4014 AcrB/AcrD/AcrF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRLPEVCIRHPIFASVLSIMAVLLGLIAFQKLDIQYFPEHTTHSASVNASIAGASADFMS
SNVADKLIAAASGIDKVDTMSTDCSEGRCSLTIKFNDDTSDIEYTNLMNKLRSSIEGIND
FPQSMIDKPTVTDDTSATDSASNIITFVNSGGMEKQAMYDYISQQLVPQLKQVQGVGAVW
GPYGGSQKAVRVWLNPEQMKALNIKAADVVGTLGSYNASFTSGAIKGKSRDFSINPLNQV
ETLEDVKDLVIKVSEGKIIRIADVAQVVMGEESLSPSMLSISRHSAMSLQILPLSNANPV
KVASNIKAEIARMQKHLPQGLEMHLAYNQADFIEAAIHEGFAALIEAVILVSLIVVLFLG
SLRAASIPIITIPVCVVGVFAVMSALGFSINVLTILAIILAIGLVVDDAIVVVENCYRHI
ENGETPFNAAIKGCQEIIFPIIAMTLTLAAVYLPIGLMSGLTADLFRQFSFTLAAAVMIS
GVVALTLSPMMSAYLINTTEQHPRWFSRVEVQLQQLNHLYINELNKWFVRKRLMFGVAVV
LVGLAGIAYWQLPKILLPAEDSGFIDVTANGPTGVGRQYHLDHNRELNSVIDGHPAVGAN
LSYIEGEPINHVLLKPWGERSEGIDEVIEDLIAKSKQSVSAYNMSFSIRSADNLNIANNL
RLELTTLDRNKDELSQTAAKVQKLLEDYPGLTNVGNSVLRDQLRYDLSIDRNAIILSGVS
YGDVTNALSTFLGSVKAADLHATDGFTYPIQVQVNLDKLSDFKVLNKLYVTSESGQALPL
SQFVSIKQTTAESNIKTFMGLDSAELTADLMPGYSTDEIKAYLDEQLPSLLNDAQGFKYN
GVVKELMDSQAGTQSLFLLALVFIYLILAAQFESFVDPLIILLTVPLCIVGALLTLAVFG
QSINIYSQIGLLTLVGLVTKHGILLVEFANKQQAQGMSAIEAALSSAKWRLRPILMTSLT
MILSAIPLALATGPGSLGLANIGLVLVGGLLAGTFFSLFVVPVAYVAMSELKARDVVAHL
RSA