Protein Info for SO3991 in Shewanella oneidensis MR-1

Name: fbp
Annotation: fructose-1,6-bisphosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 9 to 181 (173 residues), 182.4 bits, E=7.6e-58
• PF18913: FBPase_C
  • amino acids 186 to 319 (134 residues), 155.8 bits, E=5e-50

Best Hits

Swiss-Prot: 100% identical to F16PA_SHEON: Fructose-1,6-bisphosphatase class 1 (fbp) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to son:SO_3991)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• gluconeogenesis I (13/13 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• oxygenic photosynthesis (12/17 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See Q8EAB6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SO3991 fructose-1,6-bisphosphatase (NCBI ptt file) (Shewanella oneidensis MR-1)
MQTLAQHLTSKAVNESLAQLILTLADTSKAISHAVRHGALAGVLGATEQENVQGETQKKL
DIITNDMLKDALKADGTVRGLASEEEDHVVEVSANGQYLVCFDPLDGSSNIDINSLVGTI
FSVLPAPQGELTEASFLQSGRNQLAAGYVLYGPSTMLALTTGQGVQLFTLHPETNEFLLT
NATMSISPDTSEFAINMSNQRFWEAPMQTYIADLLLGKIGPREKSFNMRWIAAMVGDVHR
VLSRGGIFTYPTDNKDPKKPYKLRLMYEANPMAFLVEQAGGKASTGYETILDIQPTQIHQ
RVAVILGSANEVDACLSYHGIDSRK