Protein Info for SO3990 in Shewanella oneidensis MR-1

Annotation: dipeptidyl peptidase IV (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF00930: DPPIV_N" amino acids 148 to 473 (326 residues), 350.9 bits, see alignment E=2.2e-108 PF02129: Peptidase_S15" amino acids 518 to 671 (154 residues), 40.7 bits, see alignment E=8.4e-14 PF20434: BD-FAE" amino acids 533 to 719 (187 residues), 32.5 bits, see alignment E=2.2e-11 PF12146: Hydrolase_4" amino acids 561 to 661 (101 residues), 30.5 bits, see alignment E=8.2e-11 PF01738: DLH" amino acids 564 to 738 (175 residues), 26.9 bits, see alignment E=1.2e-09 PF00326: Peptidase_S9" amino acids 564 to 761 (198 residues), 201.9 bits, see alignment E=3.1e-63 PF00756: Esterase" amino acids 620 to 667 (48 residues), 23.9 bits, see alignment 1.1e-08

Best Hits

KEGG orthology group: K01278, dipeptidyl-peptidase 4 [EC: 3.4.14.5] (inferred from 100% identity to son:SO_3990)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAB7 at UniProt or InterPro

Protein Sequence (763 amino acids)

>SO3990 dipeptidyl peptidase IV (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKNGLASSLRAVKLGASSLLIASQLAMISTLTTASAYALEGGMTPLTIERMNASPALAG
TSPRGLKLSPDGQKVTYLAGRKDNQNFYDLWQMDVKTGKSSLLLNADKLASNELSDEEKA
RRERQRIYGEGIMEYFWADDSKALLIPAAGNLYYFSLADNSVSLLPIGEGFATDARLSPK
GNFVSFVRDQNLYVLNLATKKLEAMTTDGGGVIKNAMAEFVAQEEMDRMTGYWWAPDESA
IAFTRIDESAVELVTRNEIYADGIKLTEQRYPAAGKNNVEIQLGVVTLKNKAIDWVTLSD
DKNKDIYLPRVDWLPDSKHLSFQWQSRDQQKLDLQLVALDSLTKPKTLVKERSDAWVNLN
NDLHFLKQQSAFIWASERDGFNHLYLFDLKGKLKTQLTKGNWAVDELEFIDETAGWVYFT
GRKDTPIEKHLYRVPLAGGNIERVSSEAGMHDPVFADNQSVYLDYFNSLSQPPQVSLHGD
KGQHLAWVEQNQVKAGHPLYDYAGLWQLPEFKELKAEDGQILQTRLFKPVPFDAGKKYPA
VVRVYGGPHAQLVTNSWSEQDYFTQYLVQQGYVVFQLDNRGSAHRGTKFEQVIYRHLGEA
EVNDQKVGVDYLRSLPFVDSNNVAIYGHSYGGYMALMSLFKAPDYFKAAISGAPVTDWRL
YDTHYTERYLAHPASNEQGYEASSLFPYVKNYQSGLLMYHGMADDNVLFENSTRVYKALQ
DEGKLFQMIDYPGSKHSMRGEKVRNHLYRSLADFLDRQLKNGK