Protein Info for SO3984 in Shewanella oneidensis MR-1

Annotation: magnesium transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 261 to 283 (23 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF01544: CorA" amino acids 32 to 318 (287 residues), 217.4 bits, see alignment E=1.4e-68

Best Hits

Swiss-Prot: 39% identical to ZNTB_YERP3: Zinc transport protein ZntB (zntB) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to son:SO_3984)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAC3 at UniProt or InterPro

Protein Sequence (321 amino acids)

>SO3984 magnesium transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MHDGFIYSLVLSGEQAGSTLSPEQLDNWDPKDGLVWIHLRYRHKKARHWVLHCGLNKVES
DALLAEDTRPRTVLAGEGVLLALRGVNLNPDSAPEDMVAVRIYADNQRIISTCERELQSV
KDVAGSIMAGTGPTTTGDFIVAICERLTIRKVDFIDTLEEQLLELEEQVVSGNVKDLRTD
IAELRRQTVALRRYLGPQKEAFAKMLSEQFVLFNEPEKLKMRETTNNLIRTIEDLDALRD
RANVTQEELLSQQSEQLNKRLYFLSLVSVIFLPLGFLTGLLGVNIGGIPGADNNFAFTSF
CIILVSLVALQMVILYRFKWL