Protein Info for SO3975 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details PF01569: PAP2" amino acids 106 to 233 (128 residues), 44.2 bits, see alignment E=8.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3975)

Predicted SEED Role

"FIG01058957: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAD1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SO3975 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRHNIESNKRVTFFSFAKGHLLVPWLMFAVLIFGLEWTDADMRFASLLFNWQGGVDSWPL
RGHWITESLLHVTGRNLVILFTVVVVVAIGLSFRVDKLRLYRKGFIYLFTSLLASVLLVR
MGKSISHMTCPWDVIEFGGRMIHSSLFERLPEGAEFGQCFPGGHSSGGFAWVASYYVLKQ
CHRRYAKFGLLFGIGLGAIFGLAQELRGAHFISHDLWSLAIAWTSASLLYYGFFLYVPKV
KRISVANKVSIINANVCDKAIYKL