Protein Info for SO3969 in Shewanella oneidensis MR-1

Annotation: OmpA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 43 to 60 (18 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 42 to 88 (47 residues), 35.8 bits, see alignment 1e-12 PF13488: Gly-zipper_Omp" amino acids 45 to 93 (49 residues), 38.6 bits, see alignment 1.5e-13 PF00691: OmpA" amino acids 123 to 218 (96 residues), 72.1 bits, see alignment E=8e-24

Best Hits

Swiss-Prot: 57% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_3969)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAD7 at UniProt or InterPro

Protein Sequence (228 amino acids)

>SO3969 OmpA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MMKPSIKSLPASKLAIVVITSALIASGCTTVNPYTNEQQTAKATTGALIGAVAGAAVGVA
SSSKSDRGKGALIGAASGAALGGGIGYYMDVQETKLRQQLASTGVSVTRSGDNIILNMPN
EVTFGVDQTELSDGAKRVLNSVALVAKEYSKTQLNVLGYTDSSGSDSYNLRLSQVRASEV
GNYLMSKGVASARVKSKGMGEASPIASNANAEGRAQNRRVEIVLTPTG