Protein Info for SO3967 in Shewanella oneidensis MR-1

Annotation: molybdenum ABC transporter, periplasmic molybdenum-binding protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF13531: SBP_bac_11" amino acids 18 to 253 (236 residues), 172.6 bits, see alignment E=5.8e-55 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 21 to 155 (135 residues), 73.5 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3967)

Predicted SEED Role

"Molybdenum-binding periplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAD9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SO3967 molybdenum ABC transporter, periplasmic molybdenum-binding protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MVQGAPTHTEATTAPIELRAAGSLKAAMNDIIAAYQVKSQANVVAQYAPSGLLLKRIQEG
ERVDIFASANMKHPQALVDAGAGEKVQMFARNQLCAIAQADVPLTSANLLDTLLAPQTKL
GTSTPKADPAGDYAWAVFAKAEAIKTNAKSILEAKALQLTGGPESAKPPKDRNPYGWVME
NKQADVFLTYCTNAVLAQKEVPSLKIVALPPELAVGADYGLLVLKDANSATTALAEFILS
PEGQAILTGYGFQPPKK