Protein Info for SO3966 in Shewanella oneidensis MR-1

Name: mgtE-2
Annotation: magnesium transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 291 to 310 (20 residues), see Phobius details amino acids 317 to 343 (27 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 391 to 417 (27 residues), see Phobius details amino acids 428 to 452 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 21 to 452 (432 residues), 307.1 bits, see alignment E=1e-95 PF03448: MgtE_N" amino acids 39 to 138 (100 residues), 91.4 bits, see alignment E=9.7e-30 PF00571: CBS" amino acids 141 to 197 (57 residues), 23 bits, see alignment 1.7e-08 amino acids 204 to 259 (56 residues), 34.4 bits, see alignment 4.5e-12 PF01769: MgtE" amino acids 324 to 447 (124 residues), 108.3 bits, see alignment E=6.7e-35

Best Hits

Swiss-Prot: 30% identical to MGTE_ENTFA: Magnesium transporter MgtE (mgtE) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to son:SO_3966)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAE0 at UniProt or InterPro

Protein Sequence (454 amino acids)

>SO3966 magnesium transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MPVQVSDSLQVEHRLDQLSQALNSGMFVHVRQMLQNMASSDIALILESSPPKARQVLWQL
IDQDQLGDILDELSEELKDPLIRAMSPERVAKATASMDTDDLAYILRSLPDTVYKQVLQS
MSLQNRQRVEQALSYPDETAGSLMNTDTVTLRPDVNIDVVLRYLRQRGNLPDTTDTLYVV
DKQDKVLGGVKLADLLTCDPNTPISSIIDTDIESIPVGMSDSEVAQLFERHDWVSAPVVD
SEGKLLGRITIDDVVDVIREDAEHSMMGMAGMDDDEDTFAPVVKSTLRRSLWLTINLFAA
LLAASVSNMFEGTIEQFATIAILMTIVPSMGGVAGNQTLALVIRGIALGHIGQSNARWLI
GKELAIGFLNGLMWSILVFIAVLVWKDDIALASLIGGAMLINMTVAGLAGASIPLILKRL
KVDPALAGGMVLTTVTDVIGLFAFLGLATLYLMH