Protein Info for SO3965 in Shewanella oneidensis MR-1
Name: ptsO
Annotation: phosphocarrier protein NPR (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to PTSO_SHEVD: Phosphocarrier protein NPr (ptsO) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
KEGG orthology group: K08485, phosphocarrier protein NPr (inferred from 99% identity to she:Shewmr4_0669)Predicted SEED Role
"Phosphocarrier protein, nitrogen regulation associated"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EAE1 at UniProt or InterPro
Protein Sequence (91 amino acids)
>SO3965 phosphocarrier protein NPR (NCBI ptt file) (Shewanella oneidensis MR-1) MPKLERQVTICNKLGLHARAATKLVVLASEFDASITLIQGEKQASAASVLGLLMLETGMG KTITLIAEGPDAEPALNAICALIDAKFDEAS