Protein Info for SO3960 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 5 to 243 (239 residues), 410.6 bits, see alignment E=8.6e-128 PF00005: ABC_tran" amino acids 21 to 168 (148 residues), 127 bits, see alignment E=8.3e-41 PF12399: BCA_ABC_TP_C" amino acids 217 to 241 (25 residues), 41.6 bits, see alignment (E = 7.1e-15)

Best Hits

Swiss-Prot: 74% identical to LPTB_ECO57: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli O157:H7

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to son:SO_3960)

MetaCyc: 74% identical to lipopolysaccharide transport system ATP binding protein LptB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAE6 at UniProt or InterPro

Protein Sequence (243 amino acids)

>SO3960 ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQITLKAQNLAKSYKSRQVVKDVSLTVKTGQVVGLLGPNGAGKTTTFYMVVGLVKSDKG
HIFIDDDDLTADPMHLRARKGIGYLPQEASIFRKLTVHDNIMAVLQTRKELNSDQREEAL
EQLLEEFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKK
IIEQLKSRGLGVLITDHNVRETLDVCEHAYIVSHGSLIAEGTPAEILDNQQVRAVYLGEQ
FRL