Protein Info for SO3952 in Shewanella oneidensis MR-1
Annotation: mce-related protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to MLAD_HAEIN: Intermembrane phospholipid transport system binding protein MlaD (mlaD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 98% identity to shn:Shewana3_0680)Predicted SEED Role
"Uncharacterized ABC transporter, periplasmic component YrbD"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EAF4 at UniProt or InterPro
Protein Sequence (157 amino acids)
>SO3952 mce-related protein (NCBI ptt file) (Shewanella oneidensis MR-1) MLTRKIELLVGVFLLTGLAAFLVLVFKVANIEVQTSDSSYTLSANFTNIGGLKVRSPVKV GGVVVGRVSKIDLDPVKLVAVVTIVMDKRYDKFPETSSLAILTSGLLGEQFLGLTPGFVD DDVSMLKDGDKIDDTRSALVLEDLIGQFLYSMGSKDK