Protein Info for SO3951 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05494: MlaC" amino acids 39 to 203 (165 residues), 169.6 bits, see alignment E=2.5e-54

Best Hits

Swiss-Prot: 38% identical to MLAC_SHIFL: Intermembrane phospholipid transport system binding protein MlaC (mlaC) from Shigella flexneri

KEGG orthology group: K07323, putative toluene tolerance protein (inferred from 100% identity to son:SO_3951)

Predicted SEED Role

"Uncharacterized ABC transporter, auxiliary component YrbC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAF5 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SO3951 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFKRLSRFLLPLVWIFTATTALADDTQINTMDPYSMVKSVANKTFDRFHKDKALIDADAD
HLKVIVREELMPYIDYKYASYKVLGQYLKESTEDQRNRFVDAFQGYLVTTYAQAFTEYTN
QKVEFSPGSDFSNEKIVDVNVQIIEAGRPPIKLLFKARRLKDDSWKAFDLVAEGVSLLSS
KQSEISNLIRQQGIEPVIKMLEERTKDKVTKQPKAGK