Protein Info for SO3942 in Shewanella oneidensis MR-1

Annotation: serine protease, HtrA/DegQ/DegS family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 39 to 448 (410 residues), 507.4 bits, see alignment E=1.8e-156 PF13365: Trypsin_2" amino acids 92 to 227 (136 residues), 117.6 bits, see alignment E=3.3e-37 PF00089: Trypsin" amino acids 93 to 254 (162 residues), 76.2 bits, see alignment E=1.4e-24 PF00595: PDZ" amino acids 262 to 343 (82 residues), 54.3 bits, see alignment E=5.9e-18 amino acids 381 to 438 (58 residues), 33 bits, see alignment 2.6e-11 PF13180: PDZ_2" amino acids 267 to 357 (91 residues), 59.3 bits, see alignment E=1.6e-19 amino acids 377 to 446 (70 residues), 40 bits, see alignment E=1.6e-13 PF17820: PDZ_6" amino acids 292 to 339 (48 residues), 47.4 bits, see alignment 5.4e-16 amino acids 388 to 440 (53 residues), 39.3 bits, see alignment 1.9e-13

Best Hits

Swiss-Prot: 54% identical to DEGQ_ECOLI: Periplasmic pH-dependent serine endoprotease DegQ (degQ) from Escherichia coli (strain K12)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to son:SO_3942)

MetaCyc: 54% identical to periplasmic serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegQ, serine protease" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAG0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>SO3942 serine protease, HtrA/DegQ/DegS family (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTKLSVLSAAMLAATLTMMPAVSQAAIPQSVEGQSIPSLAPMLERTTPAVVSVAVSGTH
VSKQRVPDVFRYFFGPNAPQEQVQERPFRGLGSGVIIDADKGYIVTNNHVIDGADDIQVG
LHDGREVKAKLIGTDSESDIALLQIEAKNLVAIKTSDSDELRVGDFAVAIGNPFGLGQTV
TSGIVSALGRSGLGIEMLENFIQTDAAINSGNSGGALVNLKGELIGINTAIVAPNGGNVG
IGFAIPANMVKNLIAQIAEHGEVRRGVLGIAGRDLDSQLAQGFGLDTQHGGFVNEVSAGS
AAEKAGIKAGDIIVSVDGRAIKSFQELRAKVATMGAGAKVELGLIRDGDKKTVNVTLGEA
NQTTEKAAGAVHPMLQGASLENASKGVEITDVAQGSPAAMSGLQKGDLIVGINRTAVKDL
KSLKELLKDQEGAVALKIVRGKSMLYLVLR