Protein Info for SO3936 in Shewanella oneidensis MR-1

Name: motX
Annotation: sodium-type flagellar protein MotX (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08238: Sel1" amino acids 69 to 101 (33 residues), 22.4 bits, see alignment 7e-09 amino acids 102 to 137 (36 residues), 28.1 bits, see alignment 1.2e-10 amino acids 147 to 165 (19 residues), 13.3 bits, see alignment (E = 5.6e-06)

Best Hits

Swiss-Prot: 42% identical to MOTX_VIBPA: Sodium-type polar flagellar protein MotX (motX) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 100% identity to son:SO_3936)

Predicted SEED Role

"Sodium-type flagellar protein MotX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAG6 at UniProt or InterPro

Protein Sequence (206 amino acids)

>SO3936 sodium-type flagellar protein MotX (NCBI ptt file) (Shewanella oneidensis MR-1)
MLRTALFALLPLVSSMCFAETQAVDIYSQEQLLEMIRSEQYLAKVKQDECQLVQDIEARA
EVLKQPLYQFLWGEMLNHGTCVKANAVKGMALLREAAEQGSPEAMVKLAEYYQTGKFVIR
NKDRAVNYLLPAAASGSLAARMMLVRLYGEGYGSPRDYEMAYNWLYNNVFTDEATKKKAL
SLLQVLAAKMPASAVARAQQEHLRTR