Protein Info for SO3923 in Shewanella oneidensis MR-1

Annotation: thiH protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR03955: [FeFe] hydrogenase H-cluster radical SAM maturase HydG" amino acids 18 to 477 (460 residues), 547.2 bits, see alignment E=1.3e-168 PF04055: Radical_SAM" amino acids 97 to 252 (156 residues), 47.6 bits, see alignment E=2.1e-16 PF06968: BATS" amino acids 281 to 383 (103 residues), 60.5 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 100% identity to son:SO_3923)

Predicted SEED Role

"[FeFe]-hydrogenase maturation protein HydG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAH9 at UniProt or InterPro

Protein Sequence (479 amino acids)

>SO3923 thiH protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTHEHHSITLSDYNPNVNFIDDKAIWQTIEDASDPSREQVLAILDKARQCEGLSISETA
LLLQNQDKTLDEMLFSVAREIKNTIYGNRIVMFAPLYVSNHCANSCSYCGFNADNHELKR
KTLKQDEIRQEVAILEEMGHKRILAVYGEHPRNNVQAIVESIQTMYSVKQGKGGEIRRIN
VNCAPMSVEDFKQLKTAAIGTYQCFQETYHQDTYSQVHLKGKKTDFLYRLYAMHRAMEAG
IDDVGIGALFGLYDHRFELLAMLTHVQQLEKDCGVGPHTISFPRIEPAHGSAISEKPPYE
VDDDCFKRIVAITRLAVPYTGLIMSTRESAALRKELLELGVSQISAGSRTAPGGYQDSKQ
NQHDAEQFSLGDHREMDEIIYELVTDSDAIPSFCTGCYRKGRTGDHFMGLAKQQFIGKFC
QPNALITFKEYLNDYASEKTREAGNALIERELAKMSPSRARNVRGCLQKTDAGERDIYL