Protein Info for SO3916 in Shewanella oneidensis MR-1

Name: alr
Annotation: alanine racemase, biosynthetic (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 7 to 355 (349 residues), 410.8 bits, E=2.3e-127
• PF01168: Ala_racemase_N
  • amino acids 9 to 220 (212 residues), 247.6 bits, E=1.2e-77
• PF00842: Ala_racemase_C
  • amino acids 234 to 354 (121 residues), 143.8 bits, E=2.3e-46

Best Hits

Swiss-Prot: 100% identical to ALR_SHEON: Alanine racemase (alr) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 100% identity to son:SO_3916)

MetaCyc: 58% identical to alanine racemase 1 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• L-alanine degradation I (1/2 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (8/43 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cysteine metabolism
• D-Alanine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

See Q8EAI6 at UniProt or InterPro

Protein Sequence (358 amino acids)

>SO3916 alanine racemase, biosynthetic (NCBI ptt file) (Shewanella oneidensis MR-1)
MKPFPRAEISSSALQNNLAVLRQQASSSQVMAVVKANGYGHGLLNVAKCLNNADGFGLAR
LEEALELRAGSVKARLLLLEGFFRSTDLPLLVEHDIDTVVHHESQIEMLEQATLSKPVTV
WLKVDSGMHRLGVTPEQFSAVYARLTACKNVAKPIHLMTHFACADEPDNHYTQVQMQTFN
QLTADLPGFRTLANSAGALYWPKSQGDWIRPGIAMYGVSPVTGDCGANHGLIPAMNLVSR
LIAVREHKANQPVGYGCYWTAKQDTRLGVVAIGYGDGYPRNAPEGTPVWINGRRVPIVGR
VSMDMLTVDLGHDATDQVGDDVLLWGQALPVEEVAEHIGTIAYELVTKLTPRVAVCLA