Protein Info for SO3912 in Shewanella oneidensis MR-1

Annotation: TIM-barrel protein, yjbN family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00742: tRNA dihydrouridine synthase A
  • amino acids 15 to 328 (314 residues), 524.9 bits, E=4e-162
• PF01207: Dus
  • amino acids 18 to 321 (304 residues), 316.3 bits, E=1e-98

Best Hits

Swiss-Prot: 100% identical to DUSA_SHEON: tRNA-dihydrouridine(20/20a) synthase (dusA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 100% identity to son:SO_3912)

MetaCyc: 73% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See Q8EAJ0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>SO3912 TIM-barrel protein, yjbN family (NCBI ptt file) (Shewanella oneidensis MR-1)
MLKNNINDSKNLDRTFSIAPMLDWTDRHYRYFARLMSANALLYTEMVTTGAILHGRGDYL
TYNQEEHPLALQLGGSNPVELARCAKLAAERGYDEVNLNVGCPSDRVQNGRFGACLMAEP
ELVAECVDAMKQVVDIPVTVKTRIGIDEQDSYEFLTHFIDTVMAKGCGEFIIHARKAWLQ
GLSPKENREIPPLDYDRVYQLKRDYPALNISINGGITSLEQAQTHLQHLDGVMVGREAYQ
NPYMLAQVDQVLCGSTKAVMSREAVIEAMLPYIEAHLQVGGRLNHITRHMIGLFQGLPGA
RAWRRYLSENAHKNGAGIEVVKLAYQSVQTDLVAQ