Protein Info for SO3885 in Shewanella oneidensis MR-1

Annotation: ATPase, AAA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 signal peptide" amino acids 26 to 26 (1 residues), see Phobius details transmembrane" amino acids 27 to 45 (19 residues), see Phobius details PF00004: AAA" amino acids 230 to 356 (127 residues), 48.6 bits, see alignment E=1.2e-15 amino acids 479 to 600 (122 residues), 98 bits, see alignment E=6.3e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3885)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAL7 at UniProt or InterPro

Protein Sequence (680 amino acids)

>SO3885 ATPase, AAA family (NCBI ptt file) (Shewanella oneidensis MR-1)
MLKRAKSPRKWRANHCHYLASQLSEALMLAAITVDMVVPSSILGAITGEQIEPFLRLSLE
DASLKLPSKDRAPLNTATVKHNAQFLGQLFGLMPQMQAVLEFLIVINANAGLRELTELLI
DDDFDVLERMLQAKTTLDLEVILSQLAVFERYQLIAEATLDAPYRLLFPNVLVSILVSQK
LTSAVDFLAPMLSKSPEAQFSLSQFGHVNTDLLANYLAAITKKPSVGVNILLYGKAGTGK
TELARTLAKTIKRNLLEVQSQQLIGSQYRSDSITKATSIRLVHLSLLQGLLAHSNDSLLL
VDECEALFVQADEQYSKEQLMQALEQNPVPAIWITNHVGLLEPSFIRRFKLVMEVPVPDE
PFAYTINEHLLTPLKVSQDYHLLLAEKPNVTPAMVGNAAHVAMTLKFKGAKAEVLIDEVI
DATLEACGEEAPPPKYQGELAFDSNMVNFKVSDDAASVTTAEMLASINHAVKQAMPIRVM
LSGPPGTGKTAWVHHLAETHGFELMHIKCSDVLSKYVGDSEQNIARLFRDAHRQQKLMLI
DEVDSLLSKRDSAQALHEVQLVNELISQLECNTLPVFAATNALASIDSAVMRRFDFKLAC
DYLTSDQRQALYRQVLGIQRLNHEEVSTLNSLNQLTPGDFAILARRQRFEPKRDHRATAL
ALLTTENSRKQGQPRIGFIR