Protein Info for SO3861 in Shewanella oneidensis MR-1

Annotation: iron-sulfur cluster-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR00276: epoxyqueuosine reductase" amino acids 24 to 366 (343 residues), 492.8 bits, see alignment E=2.2e-152 PF08331: QueG_DUF1730" amino acids 72 to 155 (84 residues), 72.7 bits, see alignment E=1.9e-24 PF13484: Fer4_16" amino acids 208 to 271 (64 residues), 77.5 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to QUEG_SHEON: Epoxyqueuosine reductase (queG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_3861)

MetaCyc: 68% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAN7 at UniProt or InterPro

Protein Sequence (393 amino acids)

>SO3861 iron-sulfur cluster-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSMTVTTSSNVSDAAMLSRLALQIKSWGKALGFAQIGICDTDLTAEEAKLQTWLDKGFHG
EMAYMETHGMMRARPHELHSGTVRVISARMDYLPPEAGFATNLASPNMGYISRYAGGRDY
HKLIRARLKKLGDQINSELVALGFDAADFRPFVDSAPVLERPLAEKAGIGWTGKHSLILN
HDAGSWFFLGELLINLPLPVDIPVQEGCHSCVACITSCPTGAIVEPYTVDARRCISYLTI
ELQGAIPEEFRPLMGNRIYGCDDCQLVCPVNRAAPLTQESDFHIRPKLKQPELLTLFTWS
ETEFLKQTEGSAIRRIGHQRWLRNIAVALGNAPSSADIISALEQRKAQADVDEMVKEHID
WALAQQRAGDLQTNNRKTERLVRVIQKGLPRDA