Protein Info for SO3859 in Shewanella oneidensis MR-1

Annotation: cyclic nucleotide phosphodiesterase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 429 to 449 (21 residues), see Phobius details PF14938: SNAP" amino acids 159 to 314 (156 residues), 31.2 bits, see alignment E=5.6e-11 PF13424: TPR_12" amino acids 193 to 253 (61 residues), 35.4 bits, see alignment 3.6e-12 PF13181: TPR_8" amino acids 274 to 295 (22 residues), 12.8 bits, see alignment (E = 4e-05) TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 458 to 627 (170 residues), 140.4 bits, see alignment E=2.3e-45 PF00990: GGDEF" amino acids 462 to 622 (161 residues), 135.5 bits, see alignment E=5.1e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3859)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAN9 at UniProt or InterPro

Protein Sequence (631 amino acids)

>SO3859 cyclic nucleotide phosphodiesterase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLSYPRYLAVFLLIIGQSCLAFAEEQPQVGQLFKLFDSGESMPRATIEQNIALLEKLISS
DDIERIEKLNQIKCWNQASDTEEEIAKALNYAEQALSQIPSTASTHFITDINLCRAWFLQ
LTGDINGAMEGYTKSVQSAYEHEDIKLIADARSLRGALYSYTGDFSEALDDLVTAQGLYE
SLNLTGWANINLTDIATSFRRYGDPESAIKYYKKLKELYLKNGNKEQVANVMSEIGIALD
EMGKHEQAIEHFRFSYQYFKDQKLNIVAAINATNIAYSLIQLNRLDEAENYLNEAAPDIS
ENEPAAYSFMKLFMGKIRNQQGRYQEALDELSAAEHAFRVMHNDRGLIQLLQLKSDIYAA
MEDLPQAYHILQEFIALTKKVDDSSIAHQTTELKVKFDTSWIESENKRLIDNQKLKEQEL
TLLEKNKSLQLIILLLTGCILATVSLFAYKQVHRNRQLQTIALTDYLTQLPNRRHIYAQA
EQYFQLALKQQIPFSIIIFDADHFKKINDNFGHEIGDQALLTIAEASKTLTTDRNLVGRI
GGEEFLILLPNTDADRAWKLAHELQTLITRFGAINLPVELKLTVSAGVATLPIQSELQDQ
NFARLLKRADNALYEAKNAGRNCVKAAEITG