Protein Info for SO3849 in Shewanella oneidensis MR-1

Annotation: conserved domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03703: bPH_2
  • amino acids 57 to 126 (70 residues), 55.2 bits, E=3.5e-19

Best Hits

KEGG orthology group: K08981, putative membrane protein (inferred from 100% identity to son:SO_3849)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See Q8EAP8 at UniProt or InterPro

Protein Sequence (180 amino acids)

>SO3849 conserved domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQDNTIHEAEFEANLGLYWLLSGAAYFSLSIIGIPLLLLWFPLGLWGTRRYINNMSARLT
SKKLIVRRGILTRTENTVPLDKITDIALIQGPIMRLMGLHKLTVETAGQSGTGSLISLVG
IVDAPGFRAQILEQKERLSGLPPQPEAFPVTNDNVLLAQLVEMTASLKRIEALLTSKYNS