Protein Info for SO3805 in Shewanella oneidensis MR-1

Name: mpl
Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 454 (453 residues), 733.8 bits, see alignment E=4.3e-225 PF01225: Mur_ligase" amino acids 2 to 100 (99 residues), 83.2 bits, see alignment E=2.1e-27 PF08245: Mur_ligase_M" amino acids 111 to 297 (187 residues), 70.3 bits, see alignment E=3.5e-23 PF02875: Mur_ligase_C" amino acids 318 to 373 (56 residues), 37.7 bits, see alignment 3.2e-13

Best Hits

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to son:SO_3805)

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAT7 at UniProt or InterPro

Protein Sequence (465 amino acids)

>SO3805 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (NCBI ptt file) (Shewanella oneidensis MR-1)
MHVHILGICGTFMGGLALLARAKGHRVTGSDANVYPPMSTQLEEQGIELIQGFDPSQLGD
AGSYPDIVVIGNAMSRGNPCVEAVLNLGIPYTSGPQFLVDHILPERWVLAVSGTHGKTST
SSMLAWILEDCGYQPGFLIGGVPQNFGVSARLGESAFFVVEADEYDSAFFDKRSKFVHYH
PRTLVINNLEFDHADIFADLAAIQKQFHHQIRTVPGQGKVIWPADSHAVKQTIDMGCWSE
QETYHSSEVTKGWHAKALSDDCHEFEVFFDGQSQGVLDWALIGQHNIENAVMAIAAARHV
GVAPSAAIDALARFVPPKRRLELLDTVNGVSVYDDFAHHPTAIATTIKGMRAKVGQTKIT
IVLEPRSNTMKSGVHKDTLAHSMLQADEAFLYQADTIDWNMKEAMEAAVIPVTVLHQIDD
VVAKVAASAKPGDTIVVMSNGGFGGLHKKLLAALAVSPQLVEQAH