Protein Info for SO3780 in Shewanella oneidensis MR-1

Name: cydD
Annotation: ABC transporter, ATP-binding protein CydD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 24 to 582 (559 residues), 589.3 bits, see alignment E=4.5e-181 PF00664: ABC_membrane" amino acids 27 to 292 (266 residues), 135.5 bits, see alignment E=3e-43 PF00005: ABC_tran" amino acids 393 to 539 (147 residues), 113.2 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to son:SO_3780)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAW1 at UniProt or InterPro

Protein Sequence (646 amino acids)

>SO3780 ABC transporter, ATP-binding protein CydD (NCBI ptt file) (Shewanella oneidensis MR-1)
MDKSLEKSLLVWLKSQKKACGWFLKLSVWCGILSAIALIVQAYLIATLLDGVIIGNGLLG
FGADSAQSTIGASDYLPHLMALIGLMLLRAGLAYARERTSFEAGRRLRQHIRSAVMDKLT
RLGPAFIKGKPAGSWASIVLEQVEDLQDFYARYLPQMTLAGVIPLLILIAVFPINWAAGL
ILLLTAPLIPLFMILVGMGAADANRKNFNALARLSGRFMDRLKGLATLKLFNRGDAELKV
IEKASEEFRSRTMSVLRMAFLSSAVLEFFAAVSIAVLAVYFGFSYLGHLDFGYYGMHAHV
GPNANEGLPFSLFVGLFILILAPEFYQPLRDMGTHYHAKAQAIGAAQALMTLLEHPDPQP
TDSVASDTRLDKIESMLAQELEVFSVDGSRLLGPISFELKQGEHLALVGPSGAGKTSLLN
ALLGFLPYQGKLLINGVELSSIDLAHWRRQLAWLGQEPQLFHGTVRENVALANPNITDEQ
VWHLLEQANIHEFVRTQPLGLATAIGEQSSTLSVGQAQRIALARALAQASQVFILDEPSA
SLDSVSEQLLTLTLNRAMAGKMCIMVTHRLDQLDRMQSILVLDKGLIVQRGDFATLSVQA
GLFQTMLHENTESVADIELAAVEPQSRVDIQSDLIPTSNSTEGAAQ