Protein Info for SO3772 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 150 to 170 (21 residues), see Phobius details TIGR04211: SH3 domain protein" amino acids 15 to 181 (167 residues), 130.8 bits, see alignment E=2.5e-42 PF08239: SH3_3" amino acids 22 to 72 (51 residues), 39.1 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K07184, SH3 domain protein (inferred from 100% identity to son:SO_3772)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAW9 at UniProt or InterPro

Protein Sequence (182 amino acids)

>SO3772 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLSPNLLAEGQSRYISDNVFLYLLNGPGTDYRILGSIEAGQPITLQGETQGDYSKIVDH
KGREGWVQTNLISSTPSFREQVSTLTNELNEAKAKLAEVLNSTGNQTDEVAELKAQLAEA
QTMLAKANQERENLKMAVDHSAQETQFALWREGGIIAAAGLVVGVILVYLPRPQRRNKKR
WM