Protein Info for SO3758 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 55 to 78 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details PF05982: Sbt_1" amino acids 5 to 314 (310 residues), 350.5 bits, see alignment E=4.6e-109

Best Hits

KEGG orthology group: K07086, (no description) (inferred from 100% identity to son:SO_3758)

Predicted SEED Role

"putative sodium-dependent bicarbonate transporter" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAY3 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SO3758 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPDIVIAFFALGLLAGLVKSDLKVPPAIYETLSILLMLTLGLKGGMALHGHTQNLVFTEL
VAVVALGLLIPLALYPVLTRLVRLGRTDAISIAAHYGSVSAGTFAVVIAMVEKSGMTLRP
ETTLYLVLLELPAIVVMLWLHRYLSAKQPLQATVPNTQQSSILHEALTSRGVVLLVGGVV
IGWLYGPTGLAAISPVLLGGFKTLLALFLLEMGLVTAKVCLPLPLQQWRLLVFAAVTPFA
LAWCGIGVGLWLELPPGSILVLAGLSASASYIAAPAAIRAAIPEANIGLAMLASLGITFP
VNVLIGLPLYQHWVMQITG