Protein Info for SO3757 in Shewanella oneidensis MR-1

Name: rbcR
Annotation: rubisco operon transcriptional regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00126: HTH_1" amino acids 16 to 75 (60 residues), 60.7 bits, see alignment E=1.1e-20 PF03466: LysR_substrate" amino acids 100 to 303 (204 residues), 143.9 bits, see alignment E=4.8e-46

Best Hits

Swiss-Prot: 36% identical to CMPR_SYNY3: HTH-type transcriptional activator CmpR (cmpR) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to son:SO_3757)

Predicted SEED Role

"RuBisCO operon transcriptional regulator" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CX39 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SO3757 rubisco operon transcriptional regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MDKSSQGQLKLRHLSFRLLEVYVQVVRLGNISAAARALHLTQPTVSLQLKKLADILGEPL
LNSTDGRMSPTLVGQELYRAACDTLSRFEDVNAFIQQARGGSVGHINIGLVTTAKYVVPR
ILGAFYRQFPQVKVTLNIGNRAHILGRFERQEDDLYLFSHPPSGEQVLSARIIKNPLQLI
APKDHWAVNRQQIRFSELKQERFIMREPGSATRLMFESWCSAQGIALSDTMQIESNEAIR
LSVASGLGLSVISAHTLQEGREKPAVLSVSGFPLESNWYLVGRRDRRLPYAAMQLVEFMA
THLAECIEPEWVAADIQHLSTIFAPASLSR