Protein Info for SO3747 in Shewanella oneidensis MR-1

Annotation: sodium/hydrogen exchanger family/TrkA domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 46 (17 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 387 (372 residues), 200.7 bits, see alignment E=5.2e-63 PF02080: TrkA_C" amino acids 423 to 484 (62 residues), 45.4 bits, see alignment E=8.8e-16 PF03471: CorC_HlyC" amino acids 496 to 570 (75 residues), 33.5 bits, see alignment E=5.1e-12

Best Hits

Swiss-Prot: 100% identical to NHAP2_SHEON: K(+)/H(+) antiporter NhaP2 (nhaP2) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to son:SO_3747)

Predicted SEED Role

"K+/H+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAZ0 at UniProt or InterPro

Protein Sequence (574 amino acids)

>SO3747 sodium/hydrogen exchanger family/TrkA domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDADSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
AYLVSNFALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVG
AELSASFMLISFIKQFGLGVLLGLGGGWLLWKLVNVSKLAEGLYSILVLSGGLMIYATSN
KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
LPGLALAFGMILFARPLAVWLSLLPFKSFGSRDRWFISWVGLRGAVPIILAVFPMMAGLP
GAQLYFNLAFFVVIVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPKSEWEVFVY
CLSESKWCIGEPLKRLAMPDGTRIAAVFRNNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
SNLFSQAPETDEVSRFFGDFFIDTEVKLADLAPIYGLTLDDETGAMTVADLVALELGAHP
VLGDQFLWQSLHWVVAGLYEGKVTNVGIRLPADA