Protein Info for SO3740 in Shewanella oneidensis MR-1

Name: pntA
Annotation: NAD(P) transhydrogenase, alpha subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 166 to 189 (24 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details amino acids 423 to 441 (19 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details TIGR00561: NAD(P)(+) transhydrogenase (AB-specific), alpha subunit" amino acids 2 to 507 (506 residues), 878.6 bits, see alignment E=6.9e-269 PF05222: AlaDh_PNT_N" amino acids 4 to 134 (131 residues), 160.7 bits, see alignment E=3.5e-51 PF01262: AlaDh_PNT_C" amino acids 139 to 367 (229 residues), 242.9 bits, see alignment E=3.7e-76 PF12769: PNTB_4TM" amino acids 424 to 507 (84 residues), 125.6 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 68% identical to PNTA_HAEIN: NAD(P) transhydrogenase subunit alpha (pntA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 100% identity to son:SO_3740)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAZ7 at UniProt or InterPro

Protein Sequence (508 amino acids)

>SO3740 NAD(P) transhydrogenase, alpha subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MQIGIPRESLVGETRVAATPATVEQLKKLGFEVVVEANAGLLSSFDDAAFEAAGAKITTE
VWQADLIFKVNAPTDAEIALIKEGATLISFIWPAQNAELVEKLSKRNINVMAMDMVPRIS
RAQSLDALSSMANIGGYRAVVEAAHHFGRFFTGQITAAGKVPPAKVLVIGAGVAGLAAIG
TAGSLGAIVRAFDTRLEVAEQIESMGGQFLKLDFTNEDGSSSDGYAKTMSDEFIAAEMAL
FAEQAKEVDIIITTALIPGRPAPKLITKAMVDSMKSGSVIVDMAAQAGGNCEYTQPGELF
VTDNGVKVIGFTDLPGRLPAQSSQLYGTNLVNLMKLMCKEKDGTASINFDDVVMRNMTVV
KEGQVTFPPPPISVSAAPVKPTVKIEAKAAQAKAPSKLKYILAALGAAGFAAVASVAPAE
FLSHFTVFILSCVVGYYVVWNVSHSLHTPLMSVTNAISGIIVVGALLQIGQGSTLVTVLA
FIAVLIASINIFGGFTVTQRMLKMFRKD