Protein Info for SO3709 in Shewanella oneidensis MR-1

Annotation: ABC transporter, periplasmic substrate-binding protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF01497: Peripla_BP_2" amino acids 8 to 230 (223 residues), 89.1 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 38% identical to BTUF_VIBPA: Vitamin B12-binding protein (btuF) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K06858, vitamin B12 transport system substrate-binding protein (inferred from 100% identity to son:SO_3709)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB26 at UniProt or InterPro

Protein Sequence (254 amino acids)

>SO3709 ABC transporter, periplasmic substrate-binding protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MAEPAKRIIALSPHAVEMLYAIGAGEAIVAATDYADYPEAAKKIPSIGGYYGIQIERVLE
LNPDLVVVWDTGNKAEDINQLKSLGFKLYSSSPQTLEDVAKEIEELGQLTGHVELANQVA
TDYRRELLRLRNENAAKSEPKVFYQLWSTPLMTVAKNSWIQQIIGVCHGKNVFYDAASDY
PQVSLENVLLTLPEVILQSEEEGNVKGIDWRKWTEIPAVKNQHIYQLNADLLHRATPRAL
LGVKAVCDALDKAR