Protein Info for SO3706 in Shewanella oneidensis MR-1

Annotation: NupC family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 68 (11 residues), see Phobius details amino acids 89 to 130 (42 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 256 to 286 (31 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 331 to 348 (18 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details TIGR00804: nucleoside transporter, NupC family" amino acids 4 to 418 (415 residues), 455 bits, see alignment E=1.2e-140 PF01773: Nucleos_tra2_N" amino acids 8 to 81 (74 residues), 79.9 bits, see alignment E=2.5e-26 PF07670: Gate" amino acids 98 to 196 (99 residues), 68.7 bits, see alignment E=8.1e-23 PF07662: Nucleos_tra2_C" amino acids 201 to 416 (216 residues), 252.5 bits, see alignment E=5.3e-79

Best Hits

Swiss-Prot: 48% identical to NUPX_ECOLI: Putative nucleoside permease NupX (nupX) from Escherichia coli (strain K12)

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 100% identity to son:SO_3706)

MetaCyc: 48% identical to putative nucleoside transporter (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Na+ dependent nucleoside transporter NupC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB29 at UniProt or InterPro

Protein Sequence (422 amino acids)

>SO3706 NupC family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQILVSLLGIITLLAVAYLASENRRAINYRTVGLAFLLQLALGAFVMYSALGQSMIFSMA
AAVSNVISYSNDGMSFMFGGLVSDKMYELFGAGGFVIAFKVLPIIVFFSALSAVLYYLGI
MQLVVKAVGGALQKLLNTSKAESMSASANIFLGVTEAPLLIKPYMPRMTRSELFAVMCGG
LASIAGTMLAGYAQLGIKMEYLLAASFMAAPGGLLFAKLLIPQTETINDAHLQLTEENQP
RNLLDAATTGTMSGLSLALAVGAMLFSFISLVALFNGMLGGIGAWFGLEGLTLQQILGYL
FAPLAWLMGISWNEAMLAGSFIGQKIVINEFFAYINLAPYLSGDALVATTGQPMSERTQV
ILSFALCGFANIGTVAIAIAGIGGLVPERRAEIASLGLKALAAGILSNLMAATIAGLFMS
LS