Protein Info for SO3672 in Shewanella oneidensis MR-1

Name: exbD1
Annotation: TonB system transport protein ExbD1 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details PF02472: ExbD" amino acids 20 to 143 (124 residues), 77.6 bits, see alignment E=4.7e-26

Best Hits

Swiss-Prot: 49% identical to EXBD1_VIBCH: Biopolymer transport protein exbD1 (exbD1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to son:SO_3672)

Predicted SEED Role

"Biopolymer transport protein ExbD1" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB62 at UniProt or InterPro

Protein Sequence (145 amino acids)

>SO3672 TonB system transport protein ExbD1 (NCBI ptt file) (Shewanella oneidensis MR-1)
MISTHHTSLPQAGISALEPLPSVDLTALIDIIFIVLVFLLLTANSRLLSLPVDVPQSPSS
AIIALEHKQSIAINIMASSPYWAINGEKFADLTAFSTAFEAQLTAQPQATVIIAADKAAP
VEPLMQLLALLQGNAINQTQILMEH