Protein Info for SO3669 in Shewanella oneidensis MR-1

Name: hugA
Annotation: heme transport protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 47 to 697 (651 residues), 558.8 bits, see alignment E=1.8e-171 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 48 to 697 (650 residues), 422.5 bits, see alignment E=3.2e-130 PF07715: Plug" amino acids 61 to 165 (105 residues), 91.5 bits, see alignment E=4.9e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 283 to 670 (388 residues), 170 bits, see alignment E=1.7e-53

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to son:SO_3669)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB65 at UniProt or InterPro

Protein Sequence (697 amino acids)

>SO3669 heme transport protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKKPLVIAVAMALSSTALSFALAAEEGVKPTAVQKSAEQGVVETEFDEVLVSATRLSEK
VSETSRSVAVVAEEQLNVSQASSVAEVLKNEANINLTNGPRATSQGVEIRGLSGDRVLQT
IDGARQNTSSGHRGSYFMDPELLKSIEVIRGPASSLWGSGALGGVVAQNTKSAQDFLAPN
ETFGGYLKQGYDTNGDRTKTSGAVYGQQATVDWLLNGSYFDSNNINTGNDETLVNSASSG
SSGLAKFGWQADEASRLALSARVNKINELVPSNPSAAVSSSVPLVRRKTDDQNITLNYSL
APANNPYLDTHLQVYWNSTDYDEDRVTKGQLDSTEYRTVGINLNNSSQLGNTKLTYGVDG
YRDTLKTVRDDKGQVGQRPEDIDGETTVWGAFTRADVQLTQTVNLDAALRYDSFKNQSHN
LNASADDTELSPSLGLSWQTQPWLTLSARYDQAFRAPTVEEMFSSGTHYCIPPIPGFLPK
GLCNTFATNPNLKSEVARNKELKADFRFNELAGDDELAITLNIFRNDVDDFIVQQVSNPY
RGIPGLEQTTSWNNVEDAQLTGFELSGRYRIGQTRLAMNYGQTRGEDRNTGDYIEGMPAN
KFNVDLSQGIMEGDMKLGTRVTYVASQTNTPTGYSVAKYDEYTLWDVYLAWEPAMGVMSG
LRVDFAIENIGDEKYQQAWQTLYQPGRNMKLSARYMF