Protein Info for SO3639 in Shewanella oneidensis MR-1

Name: ksgA
Annotation: dimethyladenosine transferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00398: RrnaAD" amino acids 9 to 263 (255 residues), 270.9 bits, see alignment E=4.9e-85 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 10 to 262 (253 residues), 295 bits, see alignment E=2.2e-92

Best Hits

Swiss-Prot: 100% identical to RSMA_SHEON: Ribosomal RNA small subunit methyltransferase A (rsmA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 100% identity to son:SO_3639)

MetaCyc: 62% identical to 16S rRNA (A1518/A1519-N6-dimethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11633 [EC: 2.1.1.182]

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB93 at UniProt or InterPro

Protein Sequence (268 amino acids)

>SO3639 dimethyladenosine transferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSSKVHLGHTARKRFGQNFLTDDNVINRIVGAIAPDNDHVMVEIGPGLGALTEPVATAID
NLTVVELDRDLVERLQNHPVLKDKLTIHQGDALQFDFSQLVVPGKKLKVFGNLPYNISTP
LMFHLFEFAEQIETMHFMLQKEVVLRLSASPGTKAYGRLTVMAQYFCQVVPVLEVPPHSF
APPPKVDSAVVRLLPYAEKPFPCKDVNVLRQLCTTAFNMRRKTLRNNLKQVLSDEEFEQL
GIDQNLRPEQISVEQYVAMANMVCDKQA