Protein Info for SO3637 in Shewanella oneidensis MR-1

Name: surA
Annotation: survival protein surA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF09312: SurA_N" amino acids 27 to 143 (117 residues), 121.8 bits, see alignment E=4.5e-39 PF13624: SurA_N_3" amino acids 30 to 143 (114 residues), 41.1 bits, see alignment E=4.4e-14 PF13616: Rotamase_3" amino acids 162 to 275 (114 residues), 64.9 bits, see alignment E=2.5e-21 amino acids 281 to 384 (104 residues), 73.4 bits, see alignment E=5.8e-24 PF00639: Rotamase" amino acids 180 to 274 (95 residues), 74.5 bits, see alignment E=2.8e-24 amino acids 290 to 382 (93 residues), 89.7 bits, see alignment E=5.1e-29 PF13145: Rotamase_2" amino acids 190 to 287 (98 residues), 34.6 bits, see alignment E=7.6e-12 amino acids 301 to 388 (88 residues), 32.2 bits, see alignment E=4.4e-11

Best Hits

Swiss-Prot: 100% identical to SURA_SHEON: Chaperone SurA (surA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to son:SO_3637)

MetaCyc: 43% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB95 at UniProt or InterPro

Protein Sequence (434 amino acids)

>SO3637 survival protein surA (NCBI ptt file) (Shewanella oneidensis MR-1)
MKPSKHLIFALFALAISQPTMAAPQPLDRVAVQINDGIVLESEITNMIDTVKANAKAANQ
SLPSDSALRTQVIERLILTRLQLQMADRIGLHIGDLQLDQAIENIAREQKMTVAQMQQKI
ASEGISFSQYREQLREEITLGEIQRIQVQRRIQVSPQEITGLVKLIQEQGMKDVEYQIGH
ILIDVPNNPTSEQLEASSKRANAVLERLKSGEDFRRTAIASSSGPKALEGGIWDYMNINE
MPTLFAEVINGAKKGDIIGPIKTGAGFHIIKIMDARGLQTKEIEEVRARHILLKPSPILS
EDRAKAMLEQFLKQIRSGEAKFEDLARQYSEDPGSATKGGELGWAEPSIYVPEFAQTLNS
LSPDQISEPFRTTHGWHITQLEERRKTDATDQFNTNRAHQLIFRRKFNEELQNWLDEMRA
DAYIEVFQPESNRG