Protein Info for SO3600 in Shewanella oneidensis MR-1

Name: cysT-1
Annotation: sulfate ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 14 to 41 (28 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 10 to 273 (264 residues), 338.8 bits, see alignment E=2.5e-105 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 13 to 276 (264 residues), 406.5 bits, see alignment E=5.7e-126 PF00528: BPD_transp_1" amino acids 80 to 278 (199 residues), 71 bits, see alignment E=5.5e-24

Best Hits

Swiss-Prot: 67% identical to CYST_SALTY: Sulfate transport system permease protein CysT (cysU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to son:SO_3600)

MetaCyc: 68% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBC5 at UniProt or InterPro

Protein Sequence (281 amino acids)

>SO3600 sulfate ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIFTNGRLRHKRVLPGFSISLGVSLLFVSLILLLPTTGLIMQTSQMSWSEYWGVIADPRV
LASYKVTILSALAASIFNCLFGLLLAWVLVRYEFPGKRILDALVDLPFALPTAVAGITLA
TLYAENGQIGSLLAELGIKVAYTPLGIVVAMIFTSIPFVVRTVQPVLEELSHEEEEAGMT
LGATDAAVFWRVILPSLWPALMVGTALSFTRSLGEFGAVIFIAGNMPYISEITSLMIFVR
LQEFDFAGASAIASIVLMTSLLLLLLINLWQARYLRRIHGR