Protein Info for SO3595 in Shewanella oneidensis MR-1

Annotation: sensor protein RstB, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details PF00512: HisKA" amino acids 222 to 286 (65 residues), 41.6 bits, see alignment E=2.1e-14 PF02518: HATPase_c" amino acids 332 to 437 (106 residues), 86.2 bits, see alignment E=4.3e-28 PF14501: HATPase_c_5" amino acids 338 to 425 (88 residues), 28.3 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to son:SO_3595)

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBD0 at UniProt or InterPro

Protein Sequence (440 amino acids)

>SO3595 sensor protein RstB, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MGTRLPLRPRGLEQLSTTVKRLFISLYLLLSLSFLGIGWTLDSLWKKNVDENNPLDAPLV
AFAQLLTQLPEESRRDYLSALPTDPQLPLNLLSPDQIALPKDQILTSNHLVTTTTSEGEQ
FQFIQVGEQVLMAGPIEIDPRADLRNLFTLFFYLSLAFVALIWVGPLSRDLSILRKATKD
FGEAKWDTRINLSNRSQVKPLANTFNEMARHISALIENQKHLSNAVSHEIRTPLARLKFA
LALMPMYCKPDSDEQTRQDFLNEMQLDIKEMENLLQELLTYASLESQREGIPLDEYDLIT
LINQCIKRLSTLSETPITLHADMDALPLVGEPALIERALQNLLTNAQRFARHQILIEVSQ
TPQRVTLSVSNDGEPIPEVDLPKVFEPFYRSQSVQNGNKGHGLGLAIIKRIMQRHQGEVS
VSSNPTQTRFTLSWPKKREI