Protein Info for SO3586 in Shewanella oneidensis MR-1

Annotation: glyoxalase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF00903: Glyoxalase" amino acids 4 to 124 (121 residues), 41.6 bits, see alignment E=1.5e-14 PF13669: Glyoxalase_4" amino acids 6 to 107 (102 residues), 30.7 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3586)

Predicted SEED Role

"Glyoxalase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBD9 at UniProt or InterPro

Protein Sequence (138 amino acids)

>SO3586 glyoxalase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIHLEHINLVVDDIPKALIFYQAAFPHWRIRGGGESTWYSKPRNWTHFGDDYQYIAFSDN
GEGENRDLTGHQIGLAHFAFVVSDLDAIITRLTQAGFPIAKEGMEDPYRRNIYFFDAHGF
EVEFVEYLSDIPAERNRY