Protein Info for SO3577 in Shewanella oneidensis MR-1

Name: clpB
Annotation: clpB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 857 PF02861: Clp_N" amino acids 5 to 128 (124 residues), 117.3 bits, see alignment E=2.9e-37 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 855 (850 residues), 1437.6 bits, see alignment E=0 PF23569: NBD_SMAX1" amino acids 185 to 285 (101 residues), 29.9 bits, see alignment E=2.7e-10 PF00004: AAA" amino acids 203 to 316 (114 residues), 49.4 bits, see alignment E=3.7e-16 amino acids 602 to 722 (121 residues), 38.8 bits, see alignment E=6.7e-13 PF17871: AAA_lid_9" amino acids 342 to 444 (103 residues), 116.9 bits, see alignment E=2e-37 PF07724: AAA_2" amino acids 596 to 759 (164 residues), 235.9 bits, see alignment E=1.4e-73 PF00158: Sigma54_activat" amino acids 600 to 720 (121 residues), 25.4 bits, see alignment E=5.8e-09 PF07728: AAA_5" amino acids 601 to 721 (121 residues), 50.7 bits, see alignment E=1.1e-16 PF10431: ClpB_D2-small" amino acids 766 to 846 (81 residues), 96.4 bits, see alignment E=4.6e-31

Best Hits

Swiss-Prot: 100% identical to CLPB_SHEON: Chaperone protein ClpB (clpB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 77% identity to avr:B565_3766)

MetaCyc: 78% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBE6 at UniProt or InterPro

Protein Sequence (857 amino acids)

>SO3577 clpB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRLDRMTNKFQLAISDAQSLALGRDHQFIEPLHLMMALLNQDSGSIHPLLTQAGIRVSAL
RSLLSQELERLPQVEGTGGDVQLSQGLIRLLNLCDKLAQKRKDKYISSELFVLAALEGCD
ALAQCLKKSGATKELMEQTIEQVRGGQKVDDPNAEDQRQALKKFTVDLTERAEQGKLDPV
IGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGIKNKRVLSL
DMGALIAGAKYRGEFEERLKAVLNELAQEEGQVILFIDELHTMVGAGKGDGAMDAGNMLK
PALARGDLHCVGATTLDEYRQYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYELH
HHVEITDPAIVAAATMSHRYVSDRKLPDKAIDLIDEAASSIRMQMDSKPESLDRLERRAI
QLKLEEQALAKENDEASRRRLDHLQEELRDVEAKASELSEIWRTEKAALAGTQHIKADLE
QARLDLEVARRAGDLTRMSELQYGRIPELEKQLDLASQAEMQDMTLLRNKVTDLEIAEVL
SKATGIPVSKMLEGEREKLLQMEVALHERVIGQNEAVDAVANAIRRSRAGLADPNRPIGS
FLFLGPTGVGKTELCKSLARFLFDSESALVRIDMSEFMEKHAVSRLVGAPPGYVGYEEGG
YLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVIIMTSNL
GSDIIQEGFGHLSYSEMKSAVMNVVTHSFRPEFLNRIDESVVFHPLDAENIKHIASIQIA
SLRKRLAEKDYTLEITDEALSLIAEIGFDPVYGARPLKRALQQEMENPLAQKLLRGDLLP
GKPIKVSCVDGELVFEQ