Protein Info for SO3555 in Shewanella oneidensis MR-1

Name: purK
Annotation: phosphoribosylaminoimidazole carboxylase, ATPase subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 51% identical to PURK_HAEIN: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to son:SO_3555)

MetaCyc: 53% identical to 5-(carboxyamino)imidazole ribonucleotide synthase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide synthase. [EC: 6.3.4.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
inosine-5'-phosphate biosynthesis I (6/6 steps found)
inosine-5'-phosphate biosynthesis II (5/5 steps found)
inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBG3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SO3555 phosphoribosylaminoimidazole carboxylase, ATPase subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQTSTKPKVWVLGNGQLGAMLTHAGEPLAIDVRAVDIMTPTDDILPLAPNDIITAEREQ
WPESALSLQLSTHPHFVNGPVFSRLADRYSQKSLLDQLNVPTAPWSLVDDHTKVETLYQA
FGPRVLMKRRTGGYDGKGQHWLKQAEAGDIPHDWRNLAIAEQAINFDEEVSLVGVRTREG
QCVFYPLTLNLHQDGILMASIAPLARLDHLQAQAETMLSAIMHELEYAGVMAMECFRVGD
NLLVNELAPRVHNSGHWTQAGTHMDQFQLHLRALCGIAIPQPQVNFQCVMVNLIGIDNDP
RWLSLPNAELYWYNKEVRPGRKVGHLNLSVPNLTVLTNSISALQTWMPNQYQAPLAWILA
EFTKS