Protein Info for SO3554 in Shewanella oneidensis MR-1

Name: purE
Annotation: phosphoribosylaminoimidazole carboxylase, catalytic subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 5 to 159 (155 residues), 211 bits, E=3.2e-67
• PF00731: AIRC
  • amino acids 5 to 151 (147 residues), 210.3 bits, E=4.8e-67

Best Hits

Swiss-Prot: 75% identical to PURE_HAEIN: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to son:SO_3554)

MetaCyc: 70% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See Q8EBG4 at UniProt or InterPro

Protein Sequence (163 amino acids)

>SO3554 phosphoribosylaminoimidazole carboxylase, catalytic subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MQALVAVVMGSKSDWPTMEAAAEIMDKLQVPYHVEVVSAHRTPDKLMEFAAGAADRGFKI
IIGGAGGAAHLPGMIASKTRLPVLGVPVQSKALSGMDSLLSIVQMPKGIAVGTLAIGTAG
AFNAGLLACQILANNDVALAARLDAFREEQTRAVLDNPDPREV