Protein Info for SO3552 in Shewanella oneidensis MR-1

Annotation: von Willebrand factor type A domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF12450: vWF_A" amino acids 125 to 217 (93 residues), 119.2 bits, see alignment E=1.6e-38 PF13768: VWA_3" amino acids 234 to 391 (158 residues), 38.7 bits, see alignment E=2.6e-13 PF00092: VWA" amino acids 234 to 396 (163 residues), 58.5 bits, see alignment E=2.5e-19 PF13519: VWA_2" amino acids 235 to 339 (105 residues), 48.1 bits, see alignment E=4e-16 PF12034: YfbK_C" amino acids 410 to 593 (184 residues), 235.3 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to son:SO_3552)

Predicted SEED Role

"Von Willebrand factor type A domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBG6 at UniProt or InterPro

Protein Sequence (621 amino acids)

>SO3552 von Willebrand factor type A domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTHPLRLLNTQLVSISSHKKRHNAAVSALTLAILLGLSGCIDKQTESESRTELATQANEA
AEQQAALVQRVEAERQAKIQHENELSAKSQDMRAEHMPYIAQYAASSSVAAPGLNDDWQG
AVLPERNQFEKQVQNGIMVAGEIPVSTFSIDVDTGSYTTLRRMLKEGRLPQKDTLRVEEM
LNYFSYNYPQPNKNEAPFSVTTELAPSPYNDDMMLLRIGLKGYEQSKAELGASNLVFLLD
VSGSMASDDKLPLLQTALKMLTQQLDEQDKVSIVVYAGAAGVVLDGAAGNDIKILTYALE
QLTAGGSTNGAEGIQLAYQLAQKHFVKGGINRVILATDGDFNVGTTNLDELVDLVEVQKK
HGIGLTTLGFGMGNYNDHLMEQLANKGNGQYAYIDSVNEARKVLVEQLGATLLTIVKEVK
VQVEFNPALVSEYRLIGYENRALAREDFNNDKVDAGEIGAGHTVTALYELRYVETGHMAN
DKLRYGYNPDTGSEKYSRDEIAYLKLRYQLPDASKSQLLTYPIRADQSVKTVNQASDDFR
FAAAVAGLGQLLNQSHYLHQFDYNKLRGLTRSALGEDTMGYRHEFMQLVDTAALLAQTNQ
VPIKKSFDAENKPFPPQDKLH