Protein Info for SO3546 in Shewanella oneidensis MR-1

Name: tal
Annotation: transaldolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 3 to 316 (314 residues), 515 bits, E=4e-159
• PF00923: TAL_FSA
  • amino acids 14 to 309 (296 residues), 328.9 bits, E=1.4e-102

Best Hits

Swiss-Prot: 100% identical to TAL_SHEON: Transaldolase (tal) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to son:SO_3546)

MetaCyc: 72% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

See Q8EBH2 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SO3546 transaldolase (NCBI ptt file) (Shewanella oneidensis MR-1)
MANTLEQLKSYTTIVADTGDIEAIKRYQPEDATTNPSLILKAAQIPEYSALIDNAIAWAK
LQSTDIEQQIDDASDKLAVNIGVEILKLVPGRISTEVDARLSFDKEKSIAKAHKLVRLYQ
EAGVDKSRILIKLASTWEGICAAKELEQEGINCNLTLLFSFSQARACAEAGVYLISPFVG
RILDWYKKDTGKDYDAVNDPGVVSVTEIYNYYKQHGYNTVVMGASFRNIGEIIELAGCDR
LTIGPSLLEELANSQLAIQPKLVPTSTTVAVAEPLTEAQFRWEFNQDAMAVDKLAEGIRN
FAIDQGKLEVMLKAKLAN